50-Ton Annual rHSA Capacity. Animal-Free. Industrial Scale.
50-Ton Annual rHSA Capacity. Animal-Free. Industrial Scale.
50-Ton Annual rHSA Capacity. Animal-Free. Industrial Scale.
50-Ton Annual rHSA Capacity. Animal-Free. Industrial Scale.
CK100302S Recombinant Human IL-7 is manufactured using a CHO cell animal-free expression system, delivering high activity, high purity, and excellent batch-to-batch consistency. IL-7 is an important cytokine for maintaining T cell development, survival, and homeostatic proliferation. It mediates signaling through the IL-7 receptor to promote T cell expansion and maintain functional activity, and is widely used in immune cell culture and cell therapy.
The product is widely used in T cell culture, NK cell culture, CAR-T and CAR-NK cell manufacturing, tumor immunology research, immune cell therapy process development, and cytokine functional studies. IL-7 is often used in combination with cytokines such as IL-2, IL-15, and IL-21 to enhance immune cell expansion efficiency and maintain cellular functional phenotype.
Lyophilized powder form, convenient for transport, storage, and culture system preparation. Suitable for research, process development, and biomanufacturing applications.
Interleukins are a class of cytokines produced by and acting on multiple cell types. They play important roles in signal transduction, activation and regulation of immune cells, mediation of T and B cell activation, proliferation and differentiation, and inflammatory responses. The primary target cells of IL-7 are lymphocytes, with growth-promoting activity on B progenitor cells from human or mouse bone marrow, thymocytes, and mature peripheral T cells. (1) In synergy with stem cell growth factor (SCF), it stimulates B precursor mitosis, an effect inhibitable by TGF; however, it has no significant effect on pro-B cell growth. (2) It promotes the maturation of double-negative thymocytes and provides the initiating signal for TCR gene rearrangement during embryonic thymocyte development; however, it has no significant effect on mature T cells. (3) It induces LAK cell activity from thymocytes or peripheral blood lymphocytes, with the effector cells primarily being the CD8⁺ subset; however, IL-7-induced LAK cells do not possess NK activity. (4) IL-7 stimulates myeloid precursor cells and megakaryocytes to produce colony-forming units and platelets, facilitating recovery from cyclophosphamide-induced immunosuppression; at higher concentrations, IL-7 also enhances macrophage cytotoxic activity and induces monocyte cytokine secretion. This product is expressed in CHO cells, featuring high purity, high activity, and freedom from animal-derived contamination.
CHO cell expression
High-activity recombinant human IL-7
Animal-free production system
High purity, low endotoxin
Excellent batch-to-batch consistency
Suitable for CGT process development
Supports research and industrial-scale production
Parameter | Specification |
Ordering Information | |
Product Name | Recombinant Human IL-7 |
Synonyms | IL7, IL-7, Interleukin 7, Interleukin-7, Lymphopoietin-1, PBGF |
Product Number | CK100302S |
Specification | 50 μg / 1 mg |
Product Information | |
Accession Number | P13232 |
Gene ID | 3574 |
Amino Acid Sequence | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
Expression Host | CHO |
Predicted Molecular Weight | 17.5 kDa |
SDS-PAGE | 25–35 kDa |
Tag | C-His Tag |
Form and Formulation | Sterile-filtered through a 0.2 μm filter, lyophilized from PBS (NaCl: 137 mM, KCl: 2.7 mM, Na₂HPO₄: 10 mM, KH₂PO₄: 1.8 mM) |
Purification Method | Chromatography |
Storage Condition | -20°C to -80°C |
Product Quality | |
Sterility Test | Pass |
Endotoxin | ≤ 10 EU/mg |
Purity | ≥ 98%, SDS-PAGE (Figure 1) |
Biological Activity | Human PBMC proliferation assay, ED50 < 0.5 ng/mL, corresponding specific activity > 2×10⁶ IU/mg (Figure 2) |
Host Cell Protein Residue | < 100 ng/mg |
Mycoplasma Test | Pass |

Figure 1: Recombinant Human IL-7 purity test results, SDS-PAGE (sample NR, non-reduced, sample R, reduced)

Figure 2: Recombinant Human IL-7 biological activity test results, activity >2×106 IU/mg
This product is in lyophilized powder form. It is recommended to reconstitute with sterile water, PBS, or other suitable buffer to prepare a stock solution at 0.1–1.0 mg/mL.
After complete dissolution, further dilute to working concentration using culture medium according to experimental requirements. Aliquot for single-use storage and store at -20°C or below. Avoid repeated freeze-thaw cycles to maintain product activity and stability.
Optimal cytokine concentration may vary across different cell types and culture systems. Optimization and validation based on specific culture processes and experimental objectives are recommended to achieve the best culture results.
Ice pack transport.
Store at -20°C or below, protected from light, moisture-proof, and sealed. After reconstitution, aliquot and store at -20°C or below. Avoid repeated freeze-thaw cycles. Minimize product exposure to room temperature during handling to ensure product activity and stability.
Recombinant Human IL-7 is an important member of the γc family of cytokines, regulating T cell and NK cell proliferation, survival, and functional activation through IL-7R-mediated signaling pathways.
Widely used in:
T cell expansion and activation
NK cell culture and functional maintenance
CAR-T cell manufacturing process development
CAR-NK cell culture
Tumor immunology research
Immune cell therapy process development
Cytokine functional research
Biopharmaceutical R&D
IL-7 plays an important role in maintaining the survival of naïve T cells and memory T cells and promoting T cell homeostatic proliferation. It is one of the key cytokines commonly used in the cell and gene therapy (CGT) field.
This product is intended for research, process development, and biomanufacturing use only. Not for diagnostic, therapeutic, or clinical use in humans or animals.
Use the product as soon as possible after opening. Unused portions should be promptly sealed and stored.
Maintain aseptic technique throughout reconstitution and handling to avoid microbial contamination.
Aliquot for single-use storage to avoid repeated freeze-thaw cycles that may compromise product activity.
Optimal IL-7 concentration may vary across different cell types and culture systems. Determine optimal usage conditions through preliminary experiments.
Read the product technical datasheet carefully before use and follow relevant experimental protocols.
1. Mackall, C., Fry, T. & Gress, R. Harnessing the biology of IL-7 for therapeutic application. Nat Rev Immunol 11, 330-342 (2011).
2. Chen D, Tang T-X, Deng H, Yang X-P and Tang Z-H (2021) Interleukin-7 Biology and Its Effects on Immune Cells: Mediator of Generation, Differentiation, Survival, and Homeostasis. Front. Immunol. 12:747324.




Address: 5F, Building 33, CHAMPIONBIO, Beijing, China
Tel:13051765615
Email:support@sciprotech.com