CK1025S Recombinant Human IFN-γ is an E. coli-expressed, Tag Free recombinant protein. IFN-γ is a type II interferon and key proinflammatory cytokine that activates JAK-STAT signaling through the IFNGR1/IFNGR2 receptor complex, enhancing NK cell activity, inducing Th1 responses, and mediating broad immunostimulatory and immunoregulatory functions. Activity ≥2×10⁷ U/mg. Lyophilized powder form, suitable for research, process development, and biomanufacturing.
Background
Recombinant human interferon gamma (rhIFN-γ) is a soluble homodimeric protein composed of 143 amino acids. As a type II interferon and key proinflammatory cytokine, IFN-γ is primarily secreted by activated T lymphocytes (particularly Th1 cells and cytotoxic T cells) as well as natural killer (NK) cells. IFN-γ signals through a heterodimeric receptor complex composed of IFNGR1 (CD119) and IFNGR2. Upon receptor binding, it activates the JAK-STAT signaling pathway (primarily involving JAK1, JAK2, and STAT1), leading to the transcription of numerous interferon-stimulated genes (ISGs) and thereby mediating its broad biological effects. Beyond direct inhibition of viral replication, the more prominent role of IFN-γ lies in its immunostimulatory and immunoregulatory functions, such as enhancing NK cell activity. This product is recombinantly expressed in E. coli, featuring high purity, high activity, and freedom from animal-derived contamination.
Product Advantages
High-activity recombinant human IFN-γ
Animal-free production system
High purity, low endotoxin
Excellent batch-to-batch consistency
Suitable for CGT process development
Supports research and industrial-scale production
Product Specification
Parameter | Specification |
Product Number | CK1025S |
Specification | 50 μg / 1 mg |
Product Name | Recombinant Human IFN-γ |
Synonyms | γ-Interferon; rHuIFN-γ; IFNG; IFN-gamma; Interferon gamma |
Accession Number | P01579 (Q24-Q166) |
Gene ID | 3458 |
Amino Acid Sequence | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
Expression Host | E. coli |
Molecular Weight | 16.9 kDa |
Tag | Tag Free |
Form | Lyophilized powder |
Purification Method | Chromatography |
Buffer System | 1× PBS, pH 7.4 |
Storage Condition | -20°C to -80°C |
Sterility Test | Pass |
Endotoxin Level | ≤ 10 EU/mg |
Purity | ≥ 98%, SDS-PAGE and SEC-HPLC (Figure 1) |
Biological Activity | HT-29 cytotoxicity assay, IC50 ≤ 0.05 ng/mL, ≥ 2×10⁷ U/mg (Figure 2) |
Host Cell Protein Residue | < 100 ng/mg |
Figure 1： Recombinant Human IFNγ purity test results, left: SDS-PAGE (R, reduced); right: SEC-HPLC
Figure 2： Recombinant Human IFNγ biological activity test results, activity >2×107 IU/mg
Directions for Use
Reconstitute with sterile water, PBS, or other suitable buffer (0.1–1.0 mg/mL stock). Dilute to working concentration. Aliquot and store at -20°C or below. Avoid repeated freeze-thaw cycles.
Transport & Storage
Ice pack transport. Store at -20°C or below, protected from light, moisture-proof, and sealed.
Applications
Recombinant Human IFN-γ is a type II interferon that activates JAK-STAT signaling through the IFNGR1/IFNGR2 receptor complex.
Widely used in:
NK cell activation and functional enhancement
Th1 immune response studies
Antiviral research
Tumor immunology research
Immune cell therapy process development
Cytokine function and signaling pathway research
Biopharmaceutical R&D
Precautions
This product is intended for research, process development, and biomanufacturing use only. Not for diagnostic, therapeutic, or clinical use in humans or animals.
Use the product as soon as possible after opening. Unused portions should be promptly sealed and stored.
Maintain aseptic technique throughout reconstitution and handling to avoid microbial contamination.
Aliquot for single-use storage to avoid repeated freeze-thaw cycles that may compromise product activity.
Optimal IFN-γ concentration may vary across different experimental systems. Determine optimal usage conditions through preliminary experiments.
Read the product technical datasheet carefully before use and follow relevant experimental protocols.
References
1.Zhang, Shen-Ying, et al. "Inborn errors of interferon (IFN)-mediated immunity in humans: insights into the respective roles of IFN-α/β, IFN-γ, and IFN-λ 2.in host defense." Immunol Rev 226.1 (2008): 29-40.
3.Schroder, Kate, et al. "Interferon-γ: an overview of signals, mechanisms and functions." J Leukoc Biol 75.2 (2004): 163-189.
Miller, Catriona HT, Stephen G. Maher, and Howard A. Young. "Clinical use of interferon-γ." Ann N Y Acad Sci 1182.1 (2009): 69-79.
京公网安备11011402054163号